PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400042628
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 177aa    MW: 20499.4 Da    PI: 10.178
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400042628genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF953.5e-30959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          krienk+nrqvtfskRr g+lKKA+E+SvLCdaev +i+fs++gkl+eys+
  PGSC0003DMP400042628  9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYST 59
                          79***********************************************96 PP

2K-box99.55e-3379173598
                 K-box   5 sgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                           + ++ ++ ++  s++ e+akLk+++e Lqr+q+h+ Ge+L++Ls+ke q+Le+qL+++lk+iRs+Kn+l++e+i+ lqkk k+lqe+n+
  PGSC0003DMP400042628  79 QLNAaTDIETPGSWTLEHAKLKARLEVLQRNQKHYAGEELNTLSMKEFQNLEHQLDSALKHIRSRKNQLMHESISALQKKDKALQEQNN 167
                           5555455667789**************************************************************************** PP

                 K-box  93 aLrkkl 98 
                           +L+k++
  PGSC0003DMP400042628 168 NLSKQV 173
                           ***997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.184161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-33282IPR002100Transcription factor, MADS-box
CDDcd002651.74E-40279No hitNo description
PRINTSPR004042.6E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.7E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-313859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129714.74889176IPR002487Transcription factor, K-box
PfamPF014863.1E-2791173IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010154Biological Processfruit development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVGLIVFST KGKLFEYSTD  60
SCMERILERY ERYSYAERQL NAATDIETPG SWTLEHAKLK ARLEVLQRNQ KHYAGEELNT  120
LSMKEFQNLE HQLDSALKHI RSRKNQLMHE SISALQKKDK ALQEQNNNLS KQVINN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-22174173Myocyte-specific enhancer factor 2B
1tqe_Q2e-22174173Myocyte-specific enhancer factor 2B
1tqe_R2e-22174173Myocyte-specific enhancer factor 2B
1tqe_S2e-22174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0140570.0BT014057.1 Lycopersicon esculentum clone 133155F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006345101.11e-124PREDICTED: agamous-like MADS-box protein AGL8 homolog
SwissprotQ424291e-109AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog
TrEMBLM1CAG51e-128M1CAG5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000633131e-124(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.13e-94MIKC_MADS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]